PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676745418
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family SRS
Protein Properties Length: 371aa    MW: 38612.4 Da    PI: 7.2357
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676745418genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702228.31.4e-701402904153
     DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.aeaaskrkrelkskkqsalsstklssaeskkelet 102
                ++asCqdCGnqakkdCah RCRtCCksrgf+C thv+stWvpaakrrerqqqla+ + ++ + + +   +kr+re+   ++s+l +t+++++++++ le+
  676745418 140 NGASCQDCGNQAKKDCAHIRCRTCCKSRGFECPTHVRSTWVPAAKRRERQQQLATVQPQTHQPRgDICVPKRQRENLPPTSSSLVCTRIPTHHNSSGLEV 239
                4679**************************************************99887777665677899***************************** PP

     DUF702 103 sslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                 ++P+evss+avfrcvrvssv+dgeee+aYqtavsigGh+fkGiLyd+G+ 
  676745418 240 GDFPAEVSSPAVFRCVRVSSVEDGEEEFAYQTAVSIGGHIFKGILYDKGPG 290
                *************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051424.3E-64141289IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.1E-26143185IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.6E-27242289IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MAGFFSLDGG GGGGGGGGNS QEEHRTNTNP PPPPVSEAWL WYRNPNVNAN TTANAPSSSN  60
AAALGTLELW QNHNQQDIMF QHQQQQQQRL DLYSSAAGLG VGPSNHSQFD ISGETSNAGA  120
GRAGALMMMR SGGSGGGGGN GASCQDCGNQ AKKDCAHIRC RTCCKSRGFE CPTHVRSTWV  180
PAAKRRERQQ QLATVQPQTH QPRGDICVPK RQRENLPPTS SSLVCTRIPT HHNSSGLEVG  240
DFPAEVSSPA VFRCVRVSSV EDGEEEFAYQ TAVSIGGHIF KGILYDKGPG SSGDGVYNVI  300
TAGESSSGGG GAQQLNLITA GSVTVATASS STPNAGGIGS SSAAYIDPAA LYPTPINTFM  360
AGTQFFPNPR S
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBMTransfer from AT3G51060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2052620.0GU205262.1 Brassica rapa subsp. pekinensis stylish (STY1-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013744642.10.0PREDICTED: protein SHI RELATED SEQUENCE 1-like isoform X1
RefseqXP_013744650.10.0PREDICTED: protein SHI RELATED SEQUENCE 1-like isoform X2
SwissprotQ9SD400.0SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLA0A087GWV00.0A0A087GWV0_ARAAL; Uncharacterized protein
STRINGBra038880.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34192864
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.11e-158Lateral root primordium (LRP) protein-related